Segmentation of Protein Sequences & Quadratic Equations Formula - Science & Maths Assignment Help

Download Solution Order New Solution
Assignment Task

 

Quadratic Equations Formulae

 Segmentation of Protein Sequences 

 


Appendix B - Segmentation of Protein Sequences 
This part of the program is to simulate the digestion of a particular enzyme on a protein sequence. Here is the program specification: 
Cutting a protein sequence into fragments can be very useful within Bioinformatics, e.g. helping to identify what a particular protein is.

Different digestion enzymes cut at different positions within a protein sequence; the most commonly used one is trypsin.

It follows the following rules: 
1) Cuts the sequence after an arginine (R) 
2) Cuts the sequence after a lysine (K) 
3) Does not cut if lysine or arginine is followed by a proline (P) 

Consider the following protein sequence for apomyoglobin: 
tGLSDGEWQCWINVWGKVEADIAGHGC1EVLIRLFTGHPETLEKFOKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKEGH HEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHRPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG' 
Following the rules above, the apomyoglobin sequence would produce the following fragments (shown as they appear in the sequence from the amino- to the carboxyterminus of a protein): 
 

 Segmentation of Protein Sequences 

 


This Science & Maths Assignment has been solved by our Science & Maths Experts at My Uni Paper. Our Assignment Writing Experts are efficient to provide a fresh solution to this question. We are serving more than 10000+Students in Australia, UK & US by helping them to score HD in their academics. Our Experts are well trained to follow all marking rubrics & referencing style.

Be it a used or new solution, the quality of the work submitted by our assignment Experts remains unhampered. You may continue to expect the same or even better quality with the used and new assignment solution files respectively. There’s one thing to be noticed that you could choose one between the two and acquire an HD either way. You could choose a new assignment solution file to get yourself an exclusive, plagiarism (with free Turnitin file), expert quality assignment or order an old solution file that was considered worthy of the highest distinction.

Get It Done! Today

Country
Applicable Time Zone is AEST [Sydney, NSW] (GMT+11)
+

Every Assignment. Every Solution. Instantly. Deadline Ahead? Grab Your Sample Now.